Smush Parker - our official website forMiami Heat Guard, Smush Parker

Our Official Website for Smush Parker bio, stats, info and fans
    Smush Parker Menu

    Smush Parker Home
    Smush Parker Bio
    Smush Parker Stats
    Smush Parker Sitemap
    Smush Parker Pics
    Smush Parker Video
    Smush Parker News

    Contact Us

    Smush Parker Articles

Miami Heat forward Dorell Wright ready to test market
YMCA hosts basketball nights, opens with star
Former Dunbar Poet Sam Cassell hopes his NBA tale includes third title
From our readers Part 1: The Pistons' to-do list
Dunleavy to be Inducted in South Carolina Athletic Hall of Fame
Jazz: Boozer breaks slumps with 104-99 victory over Lakers
MVP Bryant has fans in Utah camp
Basketball: Steelheads have road trip to remember
2008 End-of-Season Awards
Dallas vs. Clippers
Clippers' roster for next season uncertain
Recap: Minnesota vs. LA Clippers
HEAT Recall Daequan Cook and Joel Anthony From NBA D-League
Pat Riley Named Hall of Fame Finalist
New tandem on display
O'Neal's absence leaves a big void
Riley: Shaq overtures began in DecemberRiley: Shaq overtures began in December
Wade, Paul, Kidd, Williams set to take part in Skills Challenge
Heat back in the race?
Cavaliers hold off Heat
Shaq goes through only half of practice but still could play Wednesday
Wade's shoulder hurting
Smush Parker on the trading block
Heat's personnel options dwindle
Report: Parker won't play again for the Heat
Heat's Wright starts again
Heat hopes road trip helps team bond
Heat's Williams gets a lesson
Riley downplays Shaquille O'Neal's ailments
Heat-Knicks Breakdown: The Decline of Shaquille O'Neal
Shaq says Heat can't wait for Wade
For Lakers, the rest is history
Shaq expected to play in finale
Heat's Smush Parker continues to improve
Only one starter sees action in Heat's loss
Wade working his way back; O'Neal says he's there
Utah Jazz: Miles set to report to training camp
Heat signs Bell to offer sheet
A wasted offseason
Mixed reviews for Marlins' Gonzalez
Heat agree to terms with Smush Parker
OB proposal concerns UM
Riley says he will coach the Heat for three more seasons
Wade needs help, but Heat can't afford it
Parker joins Heat looking for a title
Beer: Knicks Should Move Marbury
Always fun in the sun
Farmar not concerned about the competition at point guard for Lakers
Lakers retain Walton
The Jet in 20th year as youth coach
The saga of Mount Kobe
Krieger: Nuggets' three-point cupboard looks bare
Should the Lakers trade Kobe Bryant?
Gutierrez: Kobe's Game Dangerous
Baker: Does Kobe have to go it alone?
Daily Rumors: Harris Headed Out?
The Suns Aren't Trying, Either
Lakers notebook: Farmar fails to make impact
Playoff Revelations: Thabo Sefolosha
Jackson shakes up Lakers' starting lineup
Parker in there … for now
Florida becomes first team in 15 years to repeat; Brewer is MOP
Long live Cinderella
NCAA College Basketball Final Four Daily Round-Up
Jayhawks advance to Elite 8
A Month of Madness
Bruised Florida reaches Sweet 16
Vols overcome strong guard play by UVA to reach Sweet 16
Virginia Tech beats Illinois for first tournament win in 11 years
No. 2 seed Georgetown rolls over Belmont, into second round
Watching The Brackets
Several NCAA hopefuls have freshman outlook
Pac-10 Men's Notes - Brooks making new memories
Cougars prepare for Pac-10 tournament
Lakers encouraged despite loss
Kings-Lakers Preview
JAZZ: Whistle-stopped: Winning ways end with Kobe's trips to foul line
Playing with Kidd appeals to Lakers
Why the Lakers need Kidd, an Isiah puzzler and more
Kidd to replace Parker
Knicks win later, complete season sweep of Lakers
HARD TO FIGURE LAKERS
James takes backseat in Cavs’ victory
Bryant is windshield, Hawks bug
He sinks key shots in victory as his fans show support
Bryant Steals Thunder From Arenas In Lakers Win Over Wizards
Parker picks it up but still has no guarantees
Lakers Lose Kobe To Suspension, Game To Knicks
Spurs have what it takes to be a contender
Halfway-point hardware
Warriors go out
Getting to the point ... guard that is
LA enjoys a period of growth
No Defense for Scoring Barrage
98% of Kobe just enough for Lakers
LeBron, Cavs trip Kings
Grizzlies Explode Past Lakers With Huge Third Quarter
Threes
Ocean Pacific: Kings host Lakers at ARCO
Kobe or not to be
Lakers: New Year's Resolutions
With the Attention on Kobe, Parker Smushes the Magic
Wade has hot hand
Lakers wins over NJ Nets
Dominating Fourth Quarter Lifts Lakers Over Wolves
Jackson chides three-point shooters
Smush Statistical Performance
Nowitzki paces Mavs past Lakers
At the End of the First Quarter….
NBA roundup: Tuesday's action on the boards
Lakers, Spurs battle at Staples Center
Lakers out of sorts in strange loss
Lakers Beat Pacers; Bryant Sprains Ankle
Jazz, Lakers battle at Staples Center
Lakers getting a total team effort
Parker helps Spurs hold off SuperSonics
Rally for Victory
Smush feels underappreciated
Lakers a winning basketball team again
Lakers round up
Kobe leads Lakers over hapless Grizzlies
Parker searching for some 'mojo'
Lakers' Parker puzzled by slow start to season
Parker didn't meet Jackson's expectations
Parker falls out of favor
Jackson wants more from Smush
Perimeter shooting
Lakers' first loss frustrates Odom
Seattle loses to LA Lakers
Healing process continues for L.A.
A new season: Can the Lakers do it better this time?
Training Camp Preparations
Smush teams up with Felsot in his new video
Syndicated content not available

homebiographystatssitemappicsvidsnewscontact us


James takes backseat in Cavs' victory

CLEVELAND — LeBron James finally doesn’t have to do it all — all the time — for the Cavaliers.

James deferred to less-heralded teammate Sasha Pavlovic, who scored 13 of his 21 points in the fourth quarter, and Cleveland clamped down on Kobe Bryant when it mattered most in a 99-90 win over the Los Angeles Lakers on Sunday.

Pavlovic, a recent spark to Cleveland’s offense, finished with 21 points, Zydrunas Ilgauskas had 17 and Anderson Varejao 12 — 11 in the fourth — as the Cavaliers followed up a nice win over Miami on Friday with another solid effort.

James had 18 points, eight rebounds and five assists, but he bowed to Pavlovic and others down the stretch, and Cleveland’s supporting cast came through.

‘‘I feel like a prophet,’’ said James, who has been praising Pavlovic for weeks. ‘‘People were looking at me crazy. I’ve always said that if Sasha gets the opportunity, he is going to be very good. We go against each other in practice and I know what type of player he is.

‘‘He’s showing it.’’

James was outscored 25-7 by Bryant after halftime, but the All-Star forward was rewarded for sharing the ball and still got to crown the Cavaliers’ win with a soaring dunk in the final seconds.

Bryant scored 36 points to lead the Lakers, who went 3-5 on an eight-game swing through the bitterly cold East. Bryant scored Los Angeles’ first 14 points in the final period, but with Larry Hughes guarding him and the Cavs running others at him whenever he touched the ball, he didn’t score in the closing 3:39.

‘‘According to Kobe, no one else wanted to step up in that sequence,’’ Lakers coach Phil Jackson said. ‘‘That was something we were looking for: somebody else to try and get going.’’

The Lakers led by three points entering the fourth but were outscored 35-23 in the final 12 minutes as the Cavaliers, the NBA’s worst free-throw shooting team, got to the line and made 13-of-18 attempts.

‘‘Our defense pretty much caved,’’ Bryant said. ‘‘We gave them a lot of easy opportunities at the basket, a lot of free throws. The fourth quarter is when you really want to hold a team down and force them to hit shots — not put them at the free-throw line.’’

Vladimir Radmanovic scored 12 points and Lamar Odom 11 for the Lakers, whose bench was outscored 46-15.

James spent the first 5:13 of the fourth sitting down, but when he checked in, the Cavs led 74-73.

Bryant’s two free throws put the Lakers up 79-76 but Varejao made two of his own and Pavlovic hit a 3-pointer off a feed from James before Bryant’s two free throws — his last points — tied it 81-81.

Varejao, a 61-percent free-throw shooter, made two with 3:20 remaining and James, who went 8-of-12 from the line, followed by making a pair for his first points of the second half to make it 85-81.

Carried to that point by Bryant, the Lakers closed to 86-85 on Smush Parker’s jumper before James drove the lane and passed to an uncovered Varejao, who calmly sunk a 17-footer to put the Cavs ahead by three.

‘‘Those guys made plays,’’ Odom said of Cleveland’s reserves. ‘‘They understand their roles. They did a great job.’’

On the Lakers’ next trip, the Cavaliers double teamed Bryant, who had the ball slapped out of his hands by Hughes. Pavlovic picked it up and raced to the other end and was fouled by Smush Parker while making a layup.

Pavlovic, averaging 15 points in his last seven games, completed the three-point play to put the Cavs ahead 91-85.

‘‘He made a great defensive play,’’ Bryant said of Hughes. ‘‘I was looking to read some of my cutters, try to get guys involved with the double (team). He made a great play.’’

With the Cavs paying extra attention to Bryant, none of the other Lakers stepped up and when Varejao scored with 47 seconds left the Cavaliers were up 93-87 and on their way to a second straight impressive victory.

Pavlovic, who had a career-high six assists against the Heat, has gotten more playing time of late and he’s making the most of it.

‘‘I just always tell Sasha, ’You’re going to be very good for us, we’re going to need you’,’’ James said. ‘‘He has responded in the last month or so.’’

Pavlovic has averaged 15 points, 3.3 rebounds and 2.7 assists in his last seven games.

Notes: During a long TV timeout, Bryant and his teammates laughed as they watched an American Idol-inspired skit on the jumbo scoreboard which ended with the All-Star’s jersey being tossed into a garbage can. ... Bryant and James will meet again on national TV in Los Angeles on Thursday, the final game before the All-Star break. The superstars will also face off in next Saturday’s Skills Challenge in Las Vegas along with Miami’s Dwyane Wade and Phoenix’s Steve Nash. ‘‘Hopefully a lot of fans will tune in,’’ said Bryant. ‘‘I know if I was a kid I’d watch it.’’

See more at www.tribune-chronicle.com

 


    Smush Parker Links
 
    Smush Parker News
Syndicated content not available

(c) 2006 SmushParker.Org
Best viewed in 800x600


Visit our official Smush Parker website